Sale

Tesamorelin (5mg x 10)

Product Description

Tesamorelin is a growth hormone-releasing hormone (GHRH) analog that has been shown to increase growth hormone and IGF-1 levels. Tesamorelin in research is the most effective GH releasing hormone. It generates greater natural production of HGH (Human Growth Hormone). It binds and stimulates human GHRH receptors with similar potency as our own natural GHRH. And in research it has not been shown to significantly affect other pituitary hormones in the body.

Clinical trials have shown that tesamorelin significantly reduces abdominal fat with fewer side effects than human growth hormone itself. Tesamorelin has been shown to reduce lipodystrophy in HIV-infected individuals as well as similarly reducing abdominal fat in NON-HIV-Infected individuals.

According to one clinical study, 10.9 percent of patients who were given Tesamorelin experienced reductions in deep belly fat.  Reductions in trunk fat, waist size, and waist-to-hip ratios were recorded during the study. During treatment, insulin-like growth factor 1 was also boosted. However, glucose parameters were not altered. The study lasted six months in total. Overall, visceral fat levels decreased by eighteen percent.

Research has shown the following potential benefits of Tesamorelin:

  • Increases natural productions of HGH.
  • Increases IGF-1 without altering glucose parameters.
  • Reduced triglycerides
  • Reduced belly fat.
  • Reduced Carotid Intima Media Size.
  • Improved cognition in adults over the age of 60.

    Purity, Formulation & Physical Appearance

    iPharmix Tesamorelin has a peptide purity level that exceeds 99.0% as determined by HPLC. This peptide was synthesized with no additives and is supplied as a white lyophilized (freeze-dried) powder.

    Solubility & Storage

    It is recommended to reconstitute the lyophilized Tesamorelin in bacteriostatic water, which can then be further diluted in other aqueous solutions. Lyophilized Tesamorelin although stable at room temperature for 90 days, should be stored between 2-8°C. Upon reconstitution, Tesamorelin should be stored between 2-8°C out of direct light for up to 14 days. For future use  store below -18°C. Prevent repeated freeze-thaw cycles.

    Product Usage

    THIS PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. This product is not a drug and has not been approved by the FDA to prevent or cure any medical condition or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals.

    Structure

    Tesamorelin

    Source: PubChem

    Peptide Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
    Molecular Formula: C221H366N72O67S
    Molecular Weight: 5136 g/mol
    PubChem CID: 16137828
    CAS Number: 804475-66-9

    Subscribe